Lineage for d2etea1 (2ete A:1-201)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2423995Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
  6. 2424006Protein Germin [63853] (1 species)
    Metal (manganese)-binding protein with oxalate oxidase and superoxide dismutase activities; homohexamer
  7. 2424007Species Barley (Hordeum vulgare) [TaxId:4513] [63854] (4 PDB entries)
  8. 2424009Domain d2etea1: 2ete A:1-201 [132354]
    complexed with glv, mn, nag

Details for d2etea1

PDB Entry: 2ete (more details), 1.75 Å

PDB Description: recombinant oxalate oxidase in complex with glycolate
PDB Compounds: (A:) Oxalate oxidase 1

SCOPe Domain Sequences for d2etea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2etea1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]}
sdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld
vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys
rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt
kalrveagvvellkskfaggs

SCOPe Domain Coordinates for d2etea1:

Click to download the PDB-style file with coordinates for d2etea1.
(The format of our PDB-style files is described here.)

Timeline for d2etea1: