SCOP 1.75: Domain d2etea1: 2ete A:1-201

Lineage for d2etea1 (2ete A:1-201)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (24 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Germin [63853] (1 species)
   Metal (manganese)-binding protein with oxalate oxidase and superoxide dismutase activities; homohexamer

7. Species Barley (Hordeum vulgare) [TaxId:4513] [63854] (4 PDB entries)

8. Domain d2etea1: 2ete A:1-201 [132354]
   complexed with glv, mn, nag

Details for d2etea1

PDB Entry: 2ete, 1.75 Å

PDB Description: recombinant oxalate oxidase in complex with glycolate

PDB Compounds: (A:) Oxalate oxidase 1

SCOP Domain Sequences for d2etea1:

Sequence; same for both SEQRES and ATOM records:

>d2etea1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]}
sdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld
vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys
rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt
kalrveagvvellkskfaggs

Timeline for d2etea1:

• d2etea1 first appeared in SCOP 1.73
  
• d2etea1 appears in SCOPe 2.01
  
• d2etea1 appears in the current release, SCOPe 2.08