![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (20 families) ![]() |
![]() | Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins) |
![]() | Protein Germin [63853] (1 species) Metal (manganese)-binding protein with oxalate oxidase and superoxide dismutase activities; homohexamer |
![]() | Species Barley (Hordeum vulgare) [TaxId:4513] [63854] (4 PDB entries) |
![]() | Domain d2etea1: 2ete A:1-201 [132354] complexed with glv, mn, nag |
PDB Entry: 2ete (more details), 1.75 Å
SCOP Domain Sequences for d2etea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2etea1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} sdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt kalrveagvvellkskfaggs
Timeline for d2etea1: