![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.9: LemA-like [140478] (1 family) ![]() helices 2 and 3 are shorther than helices 1 and 4 automatically mapped to Pfam PF04011 |
![]() | Family a.29.9.1: LemA-like [140479] (1 protein) Pfam PF04011 |
![]() | Protein Hypothetical protein TM0961 [140480] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [140481] (1 PDB entry) Uniprot Q9X056 35-183 |
![]() | Domain d2etda1: 2etd A:35-183 [132353] Other proteins in same PDB: d2etda2 complexed with cl |
PDB Entry: 2etd (more details), 2.28 Å
SCOPe Domain Sequences for d2etda1:
Sequence, based on SEQRES records: (download)
>d2etda1 a.29.9.1 (A:35-183) Hypothetical protein TM0961 {Thermotoga maritima [TaxId: 2336]} lvsleqevqekysqiqnqlqrradlipnlvetvkgyaahekeileeianarakligaktp qesaqadaelssalsrllaiaenypnlkadanfrqlmdelagtenriavarrdyneavkk yntaikkfpgvifakmfgfeekqyfeakp
>d2etda1 a.29.9.1 (A:35-183) Hypothetical protein TM0961 {Thermotoga maritima [TaxId: 2336]} lvsleqevqekysqiqnqlqrradlipnlvetvkgyaahekeileeianarakligaktp qesaqadaelssalsrllaiaenypnlkadanfrqlmdelagtenriavarrdyneavkk yntaikkgfeekqyfeakp
Timeline for d2etda1: