Lineage for d2etda1 (2etd A:35-183)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708885Superfamily a.29.9: LemA-like [140478] (1 family) (S)
    helices 2 and 3 are shorther than helices 1 and 4
    automatically mapped to Pfam PF04011
  5. 2708886Family a.29.9.1: LemA-like [140479] (1 protein)
    Pfam PF04011
  6. 2708887Protein Hypothetical protein TM0961 [140480] (1 species)
  7. 2708888Species Thermotoga maritima [TaxId:2336] [140481] (1 PDB entry)
    Uniprot Q9X056 35-183
  8. 2708889Domain d2etda1: 2etd A:35-183 [132353]
    Other proteins in same PDB: d2etda2
    complexed with cl

Details for d2etda1

PDB Entry: 2etd (more details), 2.28 Å

PDB Description: crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution
PDB Compounds: (A:) lemA protein

SCOPe Domain Sequences for d2etda1:

Sequence, based on SEQRES records: (download)

>d2etda1 a.29.9.1 (A:35-183) Hypothetical protein TM0961 {Thermotoga maritima [TaxId: 2336]}
lvsleqevqekysqiqnqlqrradlipnlvetvkgyaahekeileeianarakligaktp
qesaqadaelssalsrllaiaenypnlkadanfrqlmdelagtenriavarrdyneavkk
yntaikkfpgvifakmfgfeekqyfeakp

Sequence, based on observed residues (ATOM records): (download)

>d2etda1 a.29.9.1 (A:35-183) Hypothetical protein TM0961 {Thermotoga maritima [TaxId: 2336]}
lvsleqevqekysqiqnqlqrradlipnlvetvkgyaahekeileeianarakligaktp
qesaqadaelssalsrllaiaenypnlkadanfrqlmdelagtenriavarrdyneavkk
yntaikkgfeekqyfeakp

SCOPe Domain Coordinates for d2etda1:

Click to download the PDB-style file with coordinates for d2etda1.
(The format of our PDB-style files is described here.)

Timeline for d2etda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2etda2