Lineage for d2et1a1 (2et1 A:1-201)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677267Superfamily b.82.1: RmlC-like cupins [51182] (20 families) (S)
  5. 677316Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 677327Protein Germin [63853] (1 species)
    Metal (manganese)-binding protein with oxalate oxidase and superoxide dismutase activities; homohexamer
  7. 677328Species Barley (Hordeum vulgare) [TaxId:4513] [63854] (4 PDB entries)
  8. 677329Domain d2et1a1: 2et1 A:1-201 [132351]
    automatically matched to d1fi2a_
    complexed with glv, mn

Details for d2et1a1

PDB Entry: 2et1 (more details), 1.6 Å

PDB Description: oxalate oxidase in complex with substrate analogue glycolate
PDB Compounds: (A:) Oxalate oxidase 1

SCOP Domain Sequences for d2et1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]}
tdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld
vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys
rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt
kalrveagvvellkskfaggs

SCOP Domain Coordinates for d2et1a1:

Click to download the PDB-style file with coordinates for d2et1a1.
(The format of our PDB-style files is described here.)

Timeline for d2et1a1: