Lineage for d2esva2 (2esv A:2-181)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719581Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (4 PDB entries)
  8. 719582Domain d2esva2: 2esv A:2-181 [132349]
    Other proteins in same PDB: d2esva1, d2esvb1
    automatically matched to d1mhea2
    complexed with iod

Details for d2esva2

PDB Entry: 2esv (more details), 2.6 Å

PDB Description: structure of the hla-e-vmaprtlil/kk50.4 tcr complex
PDB Compounds: (A:) HLA class I histocompatibility antigen, alpha chain E

SCOP Domain Sequences for d2esva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esva2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

SCOP Domain Coordinates for d2esva2:

Click to download the PDB-style file with coordinates for d2esva2.
(The format of our PDB-style files is described here.)

Timeline for d2esva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2esva1
View in 3D
Domains from other chains:
(mouse over for more information)
d2esvb1