SCOPe 2.08: Domain d2esva2: 2esv A:2-181

Lineage for d2esva2 (2esv A:2-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries)

8. Domain d2esva2: 2esv A:2-181 [132349]
   Other proteins in same PDB: d2esva1, d2esvb2, d2esvb3, d2esvd1, d2esvd2, d2esve1, d2esve2
   automatically matched to d1mhea2
   complexed with iod

Details for d2esva2

PDB Entry: 2esv, 2.6 Å

PDB Description: structure of the hla-e-vmaprtlil/kk50.4 tcr complex

PDB Compounds: (A:) HLA class I histocompatibility antigen, alpha chain E

SCOPe Domain Sequences for d2esva2:

Sequence; same for both SEQRES and ATOM records:

>d2esva2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

Timeline for d2esva2:

• d2esva2 first appeared in SCOP 1.73
  
• d2esva2 appears in SCOPe 2.07