Lineage for d2esva1 (2esv A:182-274)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026191Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2026192Species Human (Homo sapiens) [TaxId:9606] [88605] (199 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2026395Domain d2esva1: 2esv A:182-274 [132348]
    Other proteins in same PDB: d2esva2, d2esvb2, d2esvb3, d2esvd1, d2esvd2, d2esve1, d2esve2
    automatically matched to d1mhea1
    complexed with iod

Details for d2esva1

PDB Entry: 2esv (more details), 2.6 Å

PDB Description: structure of the hla-e-vmaprtlil/kk50.4 tcr complex
PDB Compounds: (A:) HLA class I histocompatibility antigen, alpha chain E

SCOPe Domain Sequences for d2esva1:

Sequence, based on SEQRES records: (download)

>d2esva1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpepvtlrw

Sequence, based on observed residues (ATOM records): (download)

>d2esva1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdtelvetrpagdgtfqkwaavv
vpsgeeqrytchvqheglpepvtlrw

SCOPe Domain Coordinates for d2esva1:

Click to download the PDB-style file with coordinates for d2esva1.
(The format of our PDB-style files is described here.)

Timeline for d2esva1: