![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries) |
![]() | Domain d2esva1: 2esv A:182-274 [132348] Other proteins in same PDB: d2esva2, d2esvb1 automatically matched to d1mhea1 complexed with iod |
PDB Entry: 2esv (more details), 2.6 Å
SCOP Domain Sequences for d2esva1:
Sequence, based on SEQRES records: (download)
>d2esva1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf qkwaavvvpsgeeqrytchvqheglpepvtlrw
>d2esva1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} leppkthvthhpisdheatlrcwalgfypaeitltwqqdtelvetrpagdgtfqkwaavv vpsgeeqrytchvqheglpepvtlrw
Timeline for d2esva1: