SCOP 1.73: Domain d2esva1: 2esv A:182-274

Lineage for d2esva1 (2esv A:182-274)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)

8. Domain d2esva1: 2esv A:182-274 [132348]
   Other proteins in same PDB: d2esva2, d2esvb1
   automatically matched to d1mhea1
   complexed with iod

Details for d2esva1

PDB Entry: 2esv, 2.6 Å

PDB Description: structure of the hla-e-vmaprtlil/kk50.4 tcr complex

PDB Compounds: (A:) HLA class I histocompatibility antigen, alpha chain E

SCOP Domain Sequences for d2esva1:

Sequence, based on SEQRES records:

>d2esva1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpepvtlrw

Sequence, based on observed residues (ATOM records):

>d2esva1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdtelvetrpagdgtfqkwaavv
vpsgeeqrytchvqheglpepvtlrw

Timeline for d2esva1:

• d2esva1 is new in SCOP 1.73
  
• d2esva1 appears in SCOP 1.75
  
• d2esva1 appears in the current release, SCOPe 2.07