Lineage for d2essa1 (2ess A:1-149)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023831Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1023832Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1024305Family d.38.1.8: Acyl-ACP thioesterase-like [143190] (2 proteins)
    Pfam PF01643; duplication: consists of two 4HBT-like domains
  6. 1024306Protein Acyl-ACP thioesterase [143191] (1 species)
  7. 1024307Species Bacteroides thetaiotaomicron [TaxId:818] [143192] (1 PDB entry)
    Uniprot Q8A611 1-149! Uniprot Q8A611 150-257
  8. 1024308Domain d2essa1: 2ess A:1-149 [132346]
    complexed with ca, cl, mpd

Details for d2essa1

PDB Entry: 2ess (more details), 1.9 Å

PDB Description: Crystal structure of an acyl-ACP thioesterase (NP_810988.1) from Bacteroides thetaiotaomicron VPI-5482 at 1.90 A resolution
PDB Compounds: (A:) acyl-ACP thioesterase

SCOPe Domain Sequences for d2essa1:

Sequence, based on SEQRES records: (download)

>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]}
mseenkigtyqfvaepfhvdfngrltmgvlgnhllncagfhasdrgfgiatlnednytwv
lsrlaieldempyqyekfsvqtwvenvyrlftdrnfavidkdgkkigyarsvwaminlnt
rkpadllalhggsivdyicdepcpiekps

Sequence, based on observed residues (ATOM records): (download)

>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]}
mseenkigtyqfvaepfhvdfngrltmgvlgnhllncagfhasdrgfgiatlnednytwv
lsrlaieldempyqyekfsvqtwvenvyrlftdrnfavidkdgkkigyarsvwaminlnt
rkpalhggsivdyicdepcpiekps

SCOPe Domain Coordinates for d2essa1:

Click to download the PDB-style file with coordinates for d2essa1.
(The format of our PDB-style files is described here.)

Timeline for d2essa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2essa2