Lineage for d2esrb1 (2esr B:28-179)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839581Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 839582Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) (S)
  5. 840288Family c.66.1.46: YhhF-like [142611] (5 proteins)
    Pfam PF03602
  6. 840307Protein Putative methyltransferase SPy1538 [142618] (1 species)
  7. 840308Species Streptococcus pyogenes [TaxId:1314] [142619] (1 PDB entry)
    Uniprot Q99YU1 28-179
  8. 840310Domain d2esrb1: 2esr B:28-179 [132345]
    automatically matched to 2ESR A:28-179
    complexed with glc

Details for d2esrb1

PDB Entry: 2esr (more details), 1.8 Å

PDB Description: conserved hypothetical protein- streptococcus pyogenes
PDB Compounds: (B:) Methyltransferase

SCOP Domain Sequences for d2esrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esrb1 c.66.1.46 (B:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]}
vrgaifnmigpyfnggrvldlfagsgglaieavsrgmsaavlveknrkaqaiiqdniimt
kaenrftllkmeaeraidcltgrfdlvfldppyaketivatiealaaknllseqvmvvce
tdktvllpkeiatlgiwkekiygiskvtvyvn

SCOP Domain Coordinates for d2esrb1:

Click to download the PDB-style file with coordinates for d2esrb1.
(The format of our PDB-style files is described here.)

Timeline for d2esrb1: