Lineage for d2esrb2 (2esr B:28-181)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894111Family c.66.1.46: YhhF-like [142611] (6 proteins)
    Pfam PF03602
  6. 2894130Protein Putative methyltransferase SPy1538 [142618] (1 species)
  7. 2894131Species Streptococcus pyogenes [TaxId:1314] [142619] (1 PDB entry)
    Uniprot Q99YU1 28-179
  8. 2894133Domain d2esrb2: 2esr B:28-181 [132345]
    Other proteins in same PDB: d2esra2, d2esrb3
    automated match to d2esra1
    complexed with glc

Details for d2esrb2

PDB Entry: 2esr (more details), 1.8 Å

PDB Description: conserved hypothetical protein- streptococcus pyogenes
PDB Compounds: (B:) Methyltransferase

SCOPe Domain Sequences for d2esrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esrb2 c.66.1.46 (B:28-181) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]}
vrgaifnmigpyfnggrvldlfagsgglaieavsrgmsaavlveknrkaqaiiqdniimt
kaenrftllkmeaeraidcltgrfdlvfldppyaketivatiealaaknllseqvmvvce
tdktvllpkeiatlgiwkekiygiskvtvyvneg

SCOPe Domain Coordinates for d2esrb2:

Click to download the PDB-style file with coordinates for d2esrb2.
(The format of our PDB-style files is described here.)

Timeline for d2esrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2esrb3