SCOPe 2.06: Domain d2esnd1: 2esn D:3-91

Lineage for d2esnd1 (2esn D:3-91)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.37: LysR-like transcriptional regulators [88979] (2 proteins)
   contains long helix in the C-terminal extension; forms dimer similar to the RTP dimer

6. Protein Probable LysR-type transcriptional regulator PA0477 [140259] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140260] (1 PDB entry)
   Uniprot Q9I641 3-91

8. Domain d2esnd1: 2esn D:3-91 [132339]
   Other proteins in same PDB: d2esna2, d2esnb2, d2esnc2, d2esnd2
   automated match to d2esna1

Details for d2esnd1

PDB Entry: 2esn, 2.1 Å

PDB Description: the crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa

PDB Compounds: (D:) probable transcriptional regulator

SCOPe Domain Sequences for d2esnd1:

Sequence; same for both SEQRES and ATOM records:

>d2esnd1 a.4.5.37 (D:3-91) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}
pllrrldlnlllvfdalyrhrnvgtaaselaisasafshalgrlrqglddelflrqgnrm
qptqraehlaaavaaalralgegleewrp

Timeline for d2esnd1:

• d2esnd1 first appeared in SCOP 1.73
  
• d2esnd1 appears in SCOPe 2.05
  
• d2esnd1 appears in SCOPe 2.07
  
• d2esnd1 appears in the current release, SCOPe 2.08