Lineage for d2esnc1 (2esn C:3-91)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 906895Family a.4.5.37: LysR-like transcriptional regulators [88979] (2 proteins)
    contains long helix in the C-terminal extension; forms dimer similar to the RTP dimer
  6. 906904Protein Probable LysR-type transcriptional regulator PA0477 [140259] (1 species)
  7. 906905Species Pseudomonas aeruginosa [TaxId:287] [140260] (1 PDB entry)
    Uniprot Q9I641 3-91
  8. 906908Domain d2esnc1: 2esn C:3-91 [132337]
    Other proteins in same PDB: d2esna2, d2esnb2, d2esnc2, d2esnd2
    automatically matched to 2ESN A:3-91

Details for d2esnc1

PDB Entry: 2esn (more details), 2.1 Å

PDB Description: the crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa
PDB Compounds: (C:) probable transcriptional regulator

SCOPe Domain Sequences for d2esnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esnc1 a.4.5.37 (C:3-91) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}
pllrrldlnlllvfdalyrhrnvgtaaselaisasafshalgrlrqglddelflrqgnrm
qptqraehlaaavaaalralgegleewrp

SCOPe Domain Coordinates for d2esnc1:

Click to download the PDB-style file with coordinates for d2esnc1.
(The format of our PDB-style files is described here.)

Timeline for d2esnc1: