SCOPe 2.07: Domain d2esnb2: 2esn B:92-305

Lineage for d2esnb2 (2esn B:92-305)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Probable LysR-type transcriptional regulator PA0477 [142812] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142813] (1 PDB entry)
   Uniprot Q9I641 92-303

8. Domain d2esnb2: 2esn B:92-305 [132336]
   Other proteins in same PDB: d2esna1, d2esnb1, d2esnc1, d2esnd1
   automated match to d2esna2

Details for d2esnb2

PDB Entry: 2esn, 2.1 Å

PDB Description: the crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa

PDB Compounds: (B:) probable transcriptional regulator

SCOPe Domain Sequences for d2esnb2:

Sequence, based on SEQRES records:

>d2esnb2 c.94.1.1 (B:92-305) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}
fvpgqsqrtfvfaatdytafallpplmnrlqhsapgvrlrlvnaerklsvealasgridf
algydeeherlpegiqahdwfadryvvvarrdhprlagaptlegylaerhavvtpwneds
gvidrllarsglrrevavqlptvlaalflagstdflltaprhaaralaeaaglalypapf
dippyvlrlyshvqhvgrdahawmigqlkgldis

Sequence, based on observed residues (ATOM records):

>d2esnb2 c.94.1.1 (B:92-305) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}
fvpgqsqrtfvfaatdytafallpplmnrlqhsapgvrlrlvnaerklsvealasgridf
algydeeherlpegiqahdwfadryvvvarrdhprlagaptlegylaerhavvtpwneds
gvidrllarsglrrevavqlptvlaalflagstdflltaprhaaralaeaaglalypapf
dippyvlrlyshvqdahawmigqlkgldis

Timeline for d2esnb2:

• d2esnb2 first appeared in SCOP 1.73
  
• d2esnb2 appears in SCOPe 2.06
  
• d2esnb2 appears in the current release, SCOPe 2.08