Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.37: LysR-like transcriptional regulators [88979] (2 proteins) contains long helix in the C-terminal extension; forms dimer similar to the RTP dimer |
Protein Probable LysR-type transcriptional regulator PA0477 [140259] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [140260] (1 PDB entry) Uniprot Q9I641 3-91 |
Domain d2esnb1: 2esn B:3-91 [132335] Other proteins in same PDB: d2esna2, d2esnb2, d2esnc2, d2esnd2 automatically matched to 2ESN A:3-91 |
PDB Entry: 2esn (more details), 2.1 Å
SCOP Domain Sequences for d2esnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2esnb1 a.4.5.37 (B:3-91) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} pllrrldlnlllvfdalyrhrnvgtaaselaisasafshalgrlrqglddelflrqgnrm qptqraehlaaavaaalralgegleewrp
Timeline for d2esnb1: