Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein Probable LysR-type transcriptional regulator PA0477 [142812] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [142813] (1 PDB entry) Uniprot Q9I641 92-303 |
Domain d2esna2: 2esn A:92-303 [132334] Other proteins in same PDB: d2esna1, d2esnb1, d2esnc1, d2esnd1 |
PDB Entry: 2esn (more details), 2.1 Å
SCOPe Domain Sequences for d2esna2:
Sequence, based on SEQRES records: (download)
>d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} fvpgqsqrtfvfaatdytafallpplmnrlqhsapgvrlrlvnaerklsvealasgridf algydeeherlpegiqahdwfadryvvvarrdhprlagaptlegylaerhavvtpwneds gvidrllarsglrrevavqlptvlaalflagstdflltaprhaaralaeaaglalypapf dippyvlrlyshvqhvgrdahawmigqlkgld
>d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} fvpgqsqrtfvfaatdytafallpplmnrlqhsapgvrlrlvnaerklsvealasgridf algydeeherlpegiqahdwfadryvvvarrdhprlagaptlegylaerhavvtpwneds gvidrllarsglrrevavqlptvlaalflagstdflltaprhaaralaeaaglalypapf dippyvlrlyshvqgrdahawmigqlkgld
Timeline for d2esna2: