Lineage for d2esna2 (2esn A:92-303)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879864Protein Probable LysR-type transcriptional regulator PA0477 [142812] (1 species)
  7. 1879865Species Pseudomonas aeruginosa [TaxId:287] [142813] (1 PDB entry)
    Uniprot Q9I641 92-303
  8. 1879866Domain d2esna2: 2esn A:92-303 [132334]
    Other proteins in same PDB: d2esna1, d2esnb1, d2esnc1, d2esnd1

Details for d2esna2

PDB Entry: 2esn (more details), 2.1 Å

PDB Description: the crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa
PDB Compounds: (A:) probable transcriptional regulator

SCOPe Domain Sequences for d2esna2:

Sequence, based on SEQRES records: (download)

>d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}
fvpgqsqrtfvfaatdytafallpplmnrlqhsapgvrlrlvnaerklsvealasgridf
algydeeherlpegiqahdwfadryvvvarrdhprlagaptlegylaerhavvtpwneds
gvidrllarsglrrevavqlptvlaalflagstdflltaprhaaralaeaaglalypapf
dippyvlrlyshvqhvgrdahawmigqlkgld

Sequence, based on observed residues (ATOM records): (download)

>d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}
fvpgqsqrtfvfaatdytafallpplmnrlqhsapgvrlrlvnaerklsvealasgridf
algydeeherlpegiqahdwfadryvvvarrdhprlagaptlegylaerhavvtpwneds
gvidrllarsglrrevavqlptvlaalflagstdflltaprhaaralaeaaglalypapf
dippyvlrlyshvqgrdahawmigqlkgld

SCOPe Domain Coordinates for d2esna2:

Click to download the PDB-style file with coordinates for d2esna2.
(The format of our PDB-style files is described here.)

Timeline for d2esna2: