SCOP 1.75: Domain d2esna2: 2esn A:92-303

Lineage for d2esna2 (2esn A:92-303)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Probable LysR-type transcriptional regulator PA0477 [142812] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142813] (1 PDB entry)
   Uniprot Q9I641 92-303

8. Domain d2esna2: 2esn A:92-303 [132334]
   Other proteins in same PDB: d2esna1, d2esnb1, d2esnc1, d2esnd1

Details for d2esna2

PDB Entry: 2esn, 2.1 Å

PDB Description: the crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa

PDB Compounds: (A:) probable transcriptional regulator

SCOP Domain Sequences for d2esna2:

Sequence, based on SEQRES records:

>d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}
fvpgqsqrtfvfaatdytafallpplmnrlqhsapgvrlrlvnaerklsvealasgridf
algydeeherlpegiqahdwfadryvvvarrdhprlagaptlegylaerhavvtpwneds
gvidrllarsglrrevavqlptvlaalflagstdflltaprhaaralaeaaglalypapf
dippyvlrlyshvqhvgrdahawmigqlkgld

Sequence, based on observed residues (ATOM records):

>d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}
fvpgqsqrtfvfaatdytafallpplmnrlqhsapgvrlrlvnaerklsvealasgridf
algydeeherlpegiqahdwfadryvvvarrdhprlagaptlegylaerhavvtpwneds
gvidrllarsglrrevavqlptvlaalflagstdflltaprhaaralaeaaglalypapf
dippyvlrlyshvqgrdahawmigqlkgld

Timeline for d2esna2:

• d2esna2 first appeared in SCOP 1.73
  
• d2esna2 appears in SCOPe 2.01
  
• d2esna2 appears in the current release, SCOPe 2.08