Class b: All beta proteins [48724] (176 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein Cyclophilin (eukaryotic) [50893] (13 species) |
Species Human (Homo sapiens), variant C [TaxId:9606] [141498] (1 PDB entry) Uniprot P45877 32-212 |
Domain d2eslf_: 2esl F: [132332] automated match to d2rmca_ complexed with ca, so4, zn |
PDB Entry: 2esl (more details), 1.9 Å
SCOPe Domain Sequences for d2eslf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eslf_ b.62.1.1 (F:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant C [TaxId: 9606]} rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad w
Timeline for d2eslf_: