Lineage for d2eslf1 (2esl F:32-212)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674493Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 674494Superfamily b.62.1: Cyclophilin-like [50891] (3 families) (S)
  5. 674495Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 protein domains)
  6. 674496Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 674614Species Human (Homo sapiens), variant C [TaxId:9606] [141498] (1 PDB entry)
  8. 674620Domain d2eslf1: 2esl F:32-212 [132332]
    automatically matched to 2ESL A:32-212
    complexed with aba, ca, so4, zn

Details for d2eslf1

PDB Entry: 2esl (more details), 1.9 Å

PDB Description: human cyclophilin c in complex with cyclosporin a
PDB Compounds: (F:) peptidyl-prolyl cis-trans isomerase c

SCOP Domain Sequences for d2eslf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eslf1 b.62.1.1 (F:32-212) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant C [TaxId: 9606]}
rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi
kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt
kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad
w

SCOP Domain Coordinates for d2eslf1:

Click to download the PDB-style file with coordinates for d2eslf1.
(The format of our PDB-style files is described here.)

Timeline for d2eslf1: