Lineage for d2esle_ (2esl E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397365Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2397366Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2397367Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2397368Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2397554Species Human (Homo sapiens), variant C [TaxId:9606] [141498] (1 PDB entry)
    Uniprot P45877 32-212
  8. 2397559Domain d2esle_: 2esl E: [132331]
    automated match to d2rmca_
    complexed with ca, so4, zn

Details for d2esle_

PDB Entry: 2esl (more details), 1.9 Å

PDB Description: human cyclophilin c in complex with cyclosporin a
PDB Compounds: (E:) peptidyl-prolyl cis-trans isomerase c

SCOPe Domain Sequences for d2esle_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esle_ b.62.1.1 (E:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant C [TaxId: 9606]}
rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi
kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt
kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad
w

SCOPe Domain Coordinates for d2esle_:

Click to download the PDB-style file with coordinates for d2esle_.
(The format of our PDB-style files is described here.)

Timeline for d2esle_: