Lineage for d2esld_ (2esl D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806648Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2806857Species Human (Homo sapiens), variant C [TaxId:9606] [141498] (1 PDB entry)
    Uniprot P45877 32-212
  8. 2806861Domain d2esld_: 2esl D: [132330]
    automated match to d2rmca_
    complexed with ca, so4, zn

Details for d2esld_

PDB Entry: 2esl (more details), 1.9 Å

PDB Description: human cyclophilin c in complex with cyclosporin a
PDB Compounds: (D:) peptidyl-prolyl cis-trans isomerase c

SCOPe Domain Sequences for d2esld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esld_ b.62.1.1 (D:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant C [TaxId: 9606]}
rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi
kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt
kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad
w

SCOPe Domain Coordinates for d2esld_:

Click to download the PDB-style file with coordinates for d2esld_.
(The format of our PDB-style files is described here.)

Timeline for d2esld_: