SCOP 1.73: Domain d2eslc1: 2esl C:32-212

Lineage for d2eslc1 (2esl C:32-212)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (3 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Human (Homo sapiens), variant C [TaxId:9606] [141498] (1 PDB entry)

8. Domain d2eslc1: 2esl C:32-212 [132329]
   automatically matched to 2ESL A:32-212
   complexed with aba, ca, so4, zn

Details for d2eslc1

PDB Entry: 2esl, 1.9 Å

PDB Description: human cyclophilin c in complex with cyclosporin a

PDB Compounds: (C:) peptidyl-prolyl cis-trans isomerase c

SCOP Domain Sequences for d2eslc1:

Sequence; same for both SEQRES and ATOM records:

>d2eslc1 b.62.1.1 (C:32-212) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant C [TaxId: 9606]}
rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi
kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt
kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad
w

Timeline for d2eslc1:

• d2eslc1 is new in SCOP 1.73
  
• d2eslc1 appears in SCOP 1.75
  
• d2eslc1 appears in the current release, SCOPe 2.08, called d2eslc_