Lineage for d2eslb_ (2esl B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416159Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2416160Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2416161Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2416162Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2416364Species Human (Homo sapiens), variant C [TaxId:9606] [141498] (1 PDB entry)
    Uniprot P45877 32-212
  8. 2416366Domain d2eslb_: 2esl B: [132328]
    automated match to d2rmca_
    complexed with ca, so4, zn

Details for d2eslb_

PDB Entry: 2esl (more details), 1.9 Å

PDB Description: human cyclophilin c in complex with cyclosporin a
PDB Compounds: (B:) peptidyl-prolyl cis-trans isomerase c

SCOPe Domain Sequences for d2eslb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eslb_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant C [TaxId: 9606]}
rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi
kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt
kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad
w

SCOPe Domain Coordinates for d2eslb_:

Click to download the PDB-style file with coordinates for d2eslb_.
(The format of our PDB-style files is described here.)

Timeline for d2eslb_: