Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (4 families) |
Family d.20.1.1: UBC-related [54496] (6 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species) |
Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (8 PDB entries) E2-17 kDa 2 |
Domain d2eska1: 2esk A:1-147 [132326] automatically matched to d1ur6a_ |
PDB Entry: 2esk (more details), 1.36 Å
SCOP Domain Sequences for d2eska1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eska1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]} malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv peiariyktdrekynriarewtqkyam
Timeline for d2eska1: