SCOPe 2.08: Domain d2eska2: 2esk A:1-147

Lineage for d2eska2 (2esk A:1-147)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (31 PDB entries)
   Uniprot P62837
   E2-17 kDa 2

8. Domain d2eska2: 2esk A:1-147 [132326]
   Other proteins in same PDB: d2eska3
   automated match to d1ur6a_

Details for d2eska2

PDB Entry: 2esk, 1.36 Å

PDB Description: human ubiquitin-conjugating enzyme (e2) ubch5b, wild-type

PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d2eska2:

Sequence; same for both SEQRES and ATOM records:

>d2eska2 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

Timeline for d2eska2:

• d2eska2 first appeared in SCOP 1.73, called d2eska1
  
• d2eska2 appears in SCOPe 2.07