Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.61: PadR-like [116807] (3 proteins) Pfam PF03551; related to the MarR-like family (Pfam PF01047) |
Protein Hypothetical protein TM0937 [140277] (1 species) |
Species Thermotoga maritima [TaxId:2336] [140278] (1 PDB entry) Uniprot Q9X035 4-117 |
Domain d2esha1: 2esh A:4-117 [132325] complexed with ca |
PDB Entry: 2esh (more details), 2.3 Å
SCOP Domain Sequences for d2esha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2esha1 a.4.5.61 (A:4-117) Hypothetical protein TM0937 {Thermotoga maritima [TaxId: 2336]} rggrgfrgwwlastilllvaekpshgyelaerlaefgieipgighmgniyrvladleesg flstewdttvspprkiyritpqgklylreilrsledmkrrietleerikrvlqe
Timeline for d2esha1: