Lineage for d2esha1 (2esh A:4-117)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762914Family a.4.5.61: PadR-like [116807] (3 proteins)
    Pfam PF03551; related to the MarR-like family (Pfam PF01047)
  6. 762918Protein Hypothetical protein TM0937 [140277] (1 species)
  7. 762919Species Thermotoga maritima [TaxId:2336] [140278] (1 PDB entry)
    Uniprot Q9X035 4-117
  8. 762920Domain d2esha1: 2esh A:4-117 [132325]
    complexed with ca

Details for d2esha1

PDB Entry: 2esh (more details), 2.3 Å

PDB Description: Crystal Structure of Conserved Protein of Unknown Function TM0937- a Potential Transcriptional Factor
PDB Compounds: (A:) conserved hypothetical protein TM0937

SCOP Domain Sequences for d2esha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esha1 a.4.5.61 (A:4-117) Hypothetical protein TM0937 {Thermotoga maritima [TaxId: 2336]}
rggrgfrgwwlastilllvaekpshgyelaerlaefgieipgighmgniyrvladleesg
flstewdttvspprkiyritpqgklylreilrsledmkrrietleerikrvlqe

SCOP Domain Coordinates for d2esha1:

Click to download the PDB-style file with coordinates for d2esha1.
(The format of our PDB-style files is described here.)

Timeline for d2esha1: