SCOPe 2.08: Domain d2esfb_: 2esf B:

Lineage for d2esfb_ (2esf B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)

6. Protein automated matches [190278] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187071] (2 PDB entries)

8. Domain d2esfb_: 2esf B: [132322]
   automated match to d1i6ob_
   complexed with bct, zn

Details for d2esfb_

PDB Entry: 2esf, 2.25 Å

PDB Description: Identification of a Novel Non-Catalytic Bicarbonate Binding Site in Eubacterial beta-Carbonic Anhydrase

PDB Compounds: (B:) Carbonic anhydrase 2

SCOPe Domain Sequences for d2esfb_:

Sequence; same for both SEQRES and ATOM records:

>d2esfb_ c.53.2.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
vhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwll
hirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgway
gihdgllrdldvtatnretleqryrhgisnlklk

Timeline for d2esfb_:

• d2esfb_ first appeared in SCOP 1.73, called d2esfb1
  
• d2esfb_ appears in SCOPe 2.07