Lineage for d2esfa_ (2esf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883013Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883078Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2883079Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)
  6. 2883111Protein automated matches [190278] (5 species)
    not a true protein
  7. 2883112Species Escherichia coli [TaxId:562] [187071] (2 PDB entries)
  8. 2883113Domain d2esfa_: 2esf A: [132321]
    automated match to d1i6ob_
    complexed with bct, zn

Details for d2esfa_

PDB Entry: 2esf (more details), 2.25 Å

PDB Description: Identification of a Novel Non-Catalytic Bicarbonate Binding Site in Eubacterial beta-Carbonic Anhydrase
PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d2esfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esfa_ c.53.2.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
didtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelfv
hrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwllh
irdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgwayg
ihdgllrdldvtatnretleqryrhgisnlklk

SCOPe Domain Coordinates for d2esfa_:

Click to download the PDB-style file with coordinates for d2esfa_.
(The format of our PDB-style files is described here.)

Timeline for d2esfa_: