SCOPe 2.06: Domain d2esca2: 2esc A:240-307

Lineage for d2esca2 (2esc A:240-307)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Cow (Bos taurus) [TaxId:9913] [110872] (2 PDB entries)
   Uniprot P30922

8. Domain d2esca2: 2esc A:240-307 [132320]
   Other proteins in same PDB: d2esca1
   automatically matched to d1sv8a2

Details for d2esca2

PDB Entry: 2esc, 2.1 Å

PDB Description: crystal structure of a 40 kda protective signalling protein from bovine (spc-40) at 2.1 a resolution

PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d2esca2:

Sequence; same for both SEQRES and ATOM records:

>d2esca2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Cow (Bos taurus) [TaxId: 9913]}
fgrsytlassstrvgapisgpgipgqftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

Timeline for d2esca2:

• d2esca2 first appeared in SCOP 1.73
  
• d2esca2 appears in SCOPe 2.05
  
• d2esca2 appears in SCOPe 2.07
  
• d2esca2 appears in the current release, SCOPe 2.08