Lineage for d2esca2 (2esc A:240-307)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720612Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 720613Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 720743Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 720766Species Sheep (Ovis aries) [TaxId:9940] [109621] (4 PDB entries)
  8. 720767Domain d2esca2: 2esc A:240-307 [132320]
    Other proteins in same PDB: d2esca1
    automatically matched to d1sv8a2
    complexed with man, nag

Details for d2esca2

PDB Entry: 2esc (more details), 2.1 Å

PDB Description: crystal structure of a 40 kda protective signalling protein from bovine (spc-40) at 2.1 a resolution
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOP Domain Sequences for d2esca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esca2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
fgrsytlassstrvgapisgpgipgqftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

SCOP Domain Coordinates for d2esca2:

Click to download the PDB-style file with coordinates for d2esca2.
(The format of our PDB-style files is described here.)

Timeline for d2esca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2esca1