Lineage for d2esca1 (2esc A:1-239,A:308-362)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 971115Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 971285Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 971312Species Sheep (Ovis aries) [TaxId:9940] [109611] (12 PDB entries)
    Uniprot Q6TMG6
  8. 971314Domain d2esca1: 2esc A:1-239,A:308-362 [132319]
    Other proteins in same PDB: d2esca2
    automatically matched to d1sv8a1

Details for d2esca1

PDB Entry: 2esc (more details), 2.1 Å

PDB Description: crystal structure of a 40 kda protective signalling protein from bovine (spc-40) at 2.1 a resolution
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d2esca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esca1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpnlktllsvggwnfgserfskiasktqsrrtfiksvppflrthgfdgldlawly
pgwrdkrhlttlvkemkaefvreaqagteqlllsaavtagkiaidrgydiaqisrhldfi
slltydfhggwrgtvghhsplfrgnsdgssrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsaikdvlarv

SCOPe Domain Coordinates for d2esca1:

Click to download the PDB-style file with coordinates for d2esca1.
(The format of our PDB-style files is described here.)

Timeline for d2esca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2esca2