SCOPe 2.06: Domain d2es9a1: 2es9 A:11-107

Lineage for d2es9a1 (2es9 A:11-107)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.247: YoaC-like [140669] (1 superfamily)
   5 helices; bundle, one crossover connection, the arrangement of the first four helices is similar to the KaiA/RbsU domain fold (101214)

4. Superfamily a.247.1: YoaC-like [140670] (1 family)
   automatically mapped to Pfam PF08986

5. Family a.247.1.1: YoaC-like [140671] (2 proteins)

6. Protein Hypothetical protein YoaC [140672] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [140673] (1 PDB entry)
   Uniprot Q8ZRJ2 11-107
   STM0327

8. Domain d2es9a1: 2es9 A:11-107 [132318]
   Other proteins in same PDB: d2es9a2

Details for d2es9a1

PDB Entry: 2es9, 2 Å

PDB Description: crystal structure of q8zrj2 from salmonella typhimurium. nesg target str65

PDB Compounds: (A:) putative cytoplasmic protein

SCOPe Domain Sequences for d2es9a1:

Sequence; same for both SEQRES and ATOM records:

>d2es9a1 a.247.1.1 (A:11-107) Hypothetical protein YoaC {Salmonella typhimurium [TaxId: 90371]}
taiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvargeqegwnpef
tkkvagwaekvasgnriliknpeyfstymqeqlkelv

Timeline for d2es9a1:

• d2es9a1 first appeared in SCOP 1.73
  
• d2es9a1 appears in SCOPe 2.05
  
• d2es9a1 appears in SCOPe 2.07
  
• d2es9a1 appears in the current release, SCOPe 2.08