Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.20: HyaE-like [142401] (2 proteins) Pfam PF07449; have evolved a different function; contains no conserved cysteine residues |
Protein Hydrogenase-1 operon protein HyaE [142402] (3 species) |
Species Salmonella typhimurium [TaxId:90371] [142404] (2 PDB entries) Uniprot Q8ZP25 7-125 |
Domain d2es7d_: 2es7 D: [132317] automated match to d2es7a1 |
PDB Entry: 2es7 (more details), 2.8 Å
SCOPe Domain Sequences for d2es7d_:
Sequence, based on SEQRES records: (download)
>d2es7d_ c.47.1.20 (D:) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} fsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiaellrefp qfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlmrsivd
>d2es7d_ c.47.1.20 (D:) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} fsalwqrlltrgwqpveasvgdgvillssdprrsdnpvmiaellrefpqfdwqvavadle qseaigdrfnvrrfpatlvftdgalsgihpwaelltlmrsivd
Timeline for d2es7d_: