Lineage for d2es7c_ (2es7 C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602275Family c.47.1.20: HyaE-like [142401] (2 proteins)
    Pfam PF07449; have evolved a different function; contains no conserved cysteine residues
  6. 1602276Protein Hydrogenase-1 operon protein HyaE [142402] (3 species)
  7. 1602279Species Salmonella typhimurium [TaxId:90371] [142404] (2 PDB entries)
    Uniprot Q8ZP25 7-125
  8. 1602282Domain d2es7c_: 2es7 C: [132316]
    automated match to d2es7a1

Details for d2es7c_

PDB Entry: 2es7 (more details), 2.8 Å

PDB Description: crystal structure of q8zp25 from salmonella typhimurium lt2. nesg target str70
PDB Compounds: (C:) putative thiol-disulfide isomerase and thioredoxin

SCOPe Domain Sequences for d2es7c_:

Sequence, based on SEQRES records: (download)

>d2es7c_ c.47.1.20 (C:) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]}
fsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiaellrefp
qfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlmrsivd

Sequence, based on observed residues (ATOM records): (download)

>d2es7c_ c.47.1.20 (C:) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]}
fsalwqrlltrgwqpveasvgdgvillssdprrsdnpvmiaellrefpqfdwqvavadle
qseaigdrfnvrrfpatlvftdgalsgihpwaelltlmrsivd

SCOPe Domain Coordinates for d2es7c_:

Click to download the PDB-style file with coordinates for d2es7c_.
(The format of our PDB-style files is described here.)

Timeline for d2es7c_: