SCOPe 2.07: Domain d2es7a1: 2es7 A:7-125

Lineage for d2es7a1 (2es7 A:7-125)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.20: HyaE-like [142401] (2 proteins)
   Pfam PF07449; have evolved a different function; contains no conserved cysteine residues

6. Protein Hydrogenase-1 operon protein HyaE [142402] (3 species)

7. Species Salmonella typhimurium [TaxId:90371] [142404] (2 PDB entries)
   Uniprot Q8ZP25 7-125

8. Domain d2es7a1: 2es7 A:7-125 [132314]

Details for d2es7a1

PDB Entry: 2es7, 2.8 Å

PDB Description: crystal structure of q8zp25 from salmonella typhimurium lt2. nesg target str70

PDB Compounds: (A:) putative thiol-disulfide isomerase and thioredoxin

SCOPe Domain Sequences for d2es7a1:

Sequence, based on SEQRES records:

>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]}
fsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiaellrefp
qfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlmrsivd

Sequence, based on observed residues (ATOM records):

>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]}
fsalwqrlltrgwqpveasvgdgvillssdprrsdnpvmiaellrefpqfdwqvavadle
qseaigdrfnvrrfpatlvftdgalsgihpwaelltlmrsivd

Timeline for d2es7a1:

• d2es7a1 first appeared in SCOP 1.73
  
• d2es7a1 appears in SCOPe 2.06
  
• d2es7a1 appears in the current release, SCOPe 2.08