Lineage for d2es7a1 (2es7 A:7-125)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133769Family c.47.1.20: HyaE-like [142401] (2 proteins)
    Pfam PF07449; have evolved a different function; contains no conserved cysteine residues
  6. 2133770Protein Hydrogenase-1 operon protein HyaE [142402] (3 species)
  7. 2133773Species Salmonella typhimurium [TaxId:90371] [142404] (2 PDB entries)
    Uniprot Q8ZP25 7-125
  8. 2133774Domain d2es7a1: 2es7 A:7-125 [132314]

Details for d2es7a1

PDB Entry: 2es7 (more details), 2.8 Å

PDB Description: crystal structure of q8zp25 from salmonella typhimurium lt2. nesg target str70
PDB Compounds: (A:) putative thiol-disulfide isomerase and thioredoxin

SCOPe Domain Sequences for d2es7a1:

Sequence, based on SEQRES records: (download)

>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]}
fsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiaellrefp
qfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlmrsivd

Sequence, based on observed residues (ATOM records): (download)

>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]}
fsalwqrlltrgwqpveasvgdgvillssdprrsdnpvmiaellrefpqfdwqvavadle
qseaigdrfnvrrfpatlvftdgalsgihpwaelltlmrsivd

SCOPe Domain Coordinates for d2es7a1:

Click to download the PDB-style file with coordinates for d2es7a1.
(The format of our PDB-style files is described here.)

Timeline for d2es7a1: