![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (22 families) ![]() |
![]() | Family c.47.1.20: HyaE-like [142401] (1 protein) Pfam PF07449; have evolved a different function; contains no conserved cysteine residues |
![]() | Protein Hydrogenase-1 operon protein HyaE [142402] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [142404] (2 PDB entries) |
![]() | Domain d2es7a1: 2es7 A:7-125 [132314] |
PDB Entry: 2es7 (more details), 2.8 Å
SCOP Domain Sequences for d2es7a1:
Sequence, based on SEQRES records: (download)
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 602]} fsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiaellrefp qfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlmrsivd
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 602]} fsalwqrlltrgwqpveasvgdgvillssdprrsdnpvmiaellrefpqfdwqvavadle qseaigdrfnvrrfpatlvftdgalsgihpwaelltlmrsivd
Timeline for d2es7a1: