Lineage for d2es4a_ (2es4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135238Family c.69.1.18: Bacterial lipase [53570] (4 protein domains)
    lack the first two strands of the common fold
  6. 2135319Protein automated matches [190277] (10 species)
    not a true protein
  7. 2135335Species Burkholderia glumae [TaxId:337] [187070] (1 PDB entry)
  8. 2135336Domain d2es4a_: 2es4 A: [132312]
    Other proteins in same PDB: d2es4d1, d2es4e_
    automated match to d1cvl__
    complexed with ca, iod

Details for d2es4a_

PDB Entry: 2es4 (more details), 1.85 Å

PDB Description: crystal structure of the burkholderia glumae lipase-specific foldase in complex with its cognate lipase
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d2es4a_:

Sequence, based on SEQRES records: (download)

>d2es4a_ c.69.1.18 (A:) automated matches {Burkholderia glumae [TaxId: 337]}
adtyaatrypvilvhglagtdkfanvvdywygiqsdlqshgakvyvanlsgfqsddgpng
rgeqllayvkqvlaatgatkvnlighsqggltsryvaavapqlvasvttigtphrgsefa
dfvqdvlktdptglsstviaafvnvfgtlvssshntdqdalaalrtlttaqtatynrnfp
saglgapgscqtgaatetvggsqhllyswggtaiqptstvlgvtgatdtstgtldvanvt
dpstlallatgavminrasgqndglvsrcsslfgqvistsyhwnhldeinqllgvrgana
edpvavirthvnrlklqgv

Sequence, based on observed residues (ATOM records): (download)

>d2es4a_ c.69.1.18 (A:) automated matches {Burkholderia glumae [TaxId: 337]}
adtyaatrypvilvhglagtdkfanvvdywygiqsdlqshgakvyvanlsgfqsddgpng
rgeqllayvkqvlaatgatkvnlighsqggltsryvaavapqlvasvttigtphrgsefa
dfvqdvlktdptglsstviaafvnvfgtlvssshntdqdalaalrtlttaqtatynrnfp
saglgapgscqtgaatetvggsqhllyswggtaiqptstvtgatdtstgtldvanvtdps
tlallatgavminrasgqndglvsrcsslfgqvistsyhwnhldeinqllgvrganaedp
vavirthvnrlklqgv

SCOPe Domain Coordinates for d2es4a_:

Click to download the PDB-style file with coordinates for d2es4a_.
(The format of our PDB-style files is described here.)

Timeline for d2es4a_: