SCOP 1.73: Domain d2es3b1: 2es3 B:10-215

Lineage for d2es3b1 (2es3 B:10-215)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.4: Laminin G-like module [49944] (6 proteins)

6. Protein Thrombospondin 1 N-terminal domain [141150] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141151] (4 PDB entries)

8. Domain d2es3b1: 2es3 B:10-215 [132311]
   automatically matched to 1Z78 A:10-215

Details for d2es3b1

PDB Entry: 2es3, 1.85 Å

PDB Description: Crystal Structure of Thrombospondin-1 N-terminal Domain in P1 Form at 1.85A Resolution

PDB Compounds: (B:) Thrombospondin-1

SCOP Domain Sequences for d2es3b1:

Sequence; same for both SEQRES and ATOM records:

>d2es3b1 b.29.1.4 (B:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nsvfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdlvdavrtekg
flllaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltvqgkqhvvsveeal
latgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasiarlriakggvndn
fqgvlqnvrfvfgttpedilrnkgcs

Timeline for d2es3b1:

• d2es3b1 is new in SCOP 1.73
  
• d2es3b1 appears in SCOP 1.75
  
• d2es3b1 appears in the current release, SCOPe 2.08, called d2es3b_