Lineage for d2es3a1 (2es3 A:10-215)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794771Family b.29.1.4: Laminin G-like module [49944] (6 proteins)
  6. 794836Protein Thrombospondin 1 N-terminal domain [141150] (1 species)
  7. 794837Species Human (Homo sapiens) [TaxId:9606] [141151] (6 PDB entries)
    Uniprot P07996 28-233! Uniprot P07996 29-233
  8. 794839Domain d2es3a1: 2es3 A:10-215 [132310]
    automatically matched to 1Z78 A:10-215

Details for d2es3a1

PDB Entry: 2es3 (more details), 1.85 Å

PDB Description: Crystal Structure of Thrombospondin-1 N-terminal Domain in P1 Form at 1.85A Resolution
PDB Compounds: (A:) Thrombospondin-1

SCOP Domain Sequences for d2es3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2es3a1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nsvfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdlvdavrtekg
flllaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltvqgkqhvvsveeal
latgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasiarlriakggvndn
fqgvlqnvrfvfgttpedilrnkgcs

SCOP Domain Coordinates for d2es3a1:

Click to download the PDB-style file with coordinates for d2es3a1.
(The format of our PDB-style files is described here.)

Timeline for d2es3a1: