![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Major cold shock protein [50283] (4 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [50285] (12 PDB entries) |
![]() | Domain d2es2a_: 2es2 A: [132309] automated match to d1csp__ protein/DNA complex; complexed with ca |
PDB Entry: 2es2 (more details), 1.78 Å
SCOPe Domain Sequences for d2es2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2es2a_ b.40.4.5 (A:) Major cold shock protein {Bacillus subtilis [TaxId: 1423]} mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa anvtkea
Timeline for d2es2a_: