SCOPe 2.08: Domain d2eryb_: 2ery B:

Lineage for d2eryb_ (2ery B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d2eryb_: 2ery B: [132307]
   Other proteins in same PDB: d2erya1, d2erya2
   automated match to d1aa9__
   complexed with gdp, mg

Details for d2eryb_

PDB Entry: 2ery, 1.7 Å

PDB Description: The crystal structure of the Ras related protein RRas2 (RRAS2) in the GDP bound state

PDB Compounds: (B:) Ras-related protein R-Ras2

SCOPe Domain Sequences for d2eryb_:

Sequence; same for both SEQRES and ATOM records:

>d2eryb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekyrlvvvggggvgksaltiqfiqsyfvtdydptiedsytkqcviddraarldildtagq
eefgamreqymrtgegfllvfsvtdrgsfeeiykfqrqilrvkdrdefpmilignkadld
hqrqvtqeegqqlarqlkvtymeasakirmnvdqafhelvrvirkfqeq

Timeline for d2eryb_:

• d2eryb_ first appeared in SCOP 1.73, called d2eryb1
  
• d2eryb_ appears in SCOPe 2.07