Lineage for d2erya1 (2ery A:10-180)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846451Protein r-Ras2 [142281] (1 species)
  7. 1846452Species Human (Homo sapiens) [TaxId:9606] [142282] (1 PDB entry)
    Uniprot P62070 10-180
  8. 1846453Domain d2erya1: 2ery A:10-180 [132306]
    Other proteins in same PDB: d2eryb_
    complexed with gdp, mg

Details for d2erya1

PDB Entry: 2ery (more details), 1.7 Å

PDB Description: The crystal structure of the Ras related protein RRas2 (RRAS2) in the GDP bound state
PDB Compounds: (A:) Ras-related protein R-Ras2

SCOPe Domain Sequences for d2erya1:

Sequence, based on SEQRES records: (download)

>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}
smqekyrlvvvggggvgksaltiqfiqsyfvtdydptiedsytkqcviddraarldildt
agqeefgamreqymrtgegfllvfsvtdrgsfeeiykfqrqilrvkdrdefpmilignka
dldhqrqvtqeegqqlarqlkvtymeasakirmnvdqafhelvrvirkfqe

Sequence, based on observed residues (ATOM records): (download)

>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}
smqekyrlvvvggggvgksaltiqfiqsyfvtdydptiedsytkqcviddraarldildt
afgamreqymrtgegfllvfsvtdrgsfeeiykfqrqilrvkdrdefpmilignkadldh
qrqvtqeegqqlarqlkvtymeasakirmnvdqafhelvrvirkfqe

SCOPe Domain Coordinates for d2erya1:

Click to download the PDB-style file with coordinates for d2erya1.
(The format of our PDB-style files is described here.)

Timeline for d2erya1: