Lineage for d2erra1 (2err A:109-196)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724311Protein Ataxin-2-binding protein 1 [143292] (1 species)
  7. 724312Species Human (Homo sapiens) [TaxId:9606] [143293] (1 PDB entry)
  8. 724313Domain d2erra1: 2err A:109-196 [132303]

Details for d2erra1

PDB Entry: 2err (more details)

PDB Description: nmr structure of the rna binding domain of human fox-1 in complex with ugcaugu
PDB Compounds: (A:) Ataxin-2-binding protein 1

SCOP Domain Sequences for d2erra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erra1 d.58.7.1 (A:109-196) Ataxin-2-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}
ntenksqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensad
adrareklhgtvvegrkievnnatarvm

SCOP Domain Coordinates for d2erra1:

Click to download the PDB-style file with coordinates for d2erra1.
(The format of our PDB-style files is described here.)

Timeline for d2erra1: