Lineage for d2erjg2 (2erj G:130-226)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787437Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 787438Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
    Pfam PF00041
  6. 787469Protein Cytokine receptor common gamma chain [141041] (1 species)
  7. 787470Species Human (Homo sapiens) [TaxId:9606] [141042] (3 PDB entries)
    Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141
  8. 787478Domain d2erjg2: 2erj G:130-226 [132300]
    Other proteins in same PDB: d2erja1, d2erja2, d2erjb1, d2erjb2, d2erjd1, d2erje1, d2erje2, d2erjf1, d2erjf2, d2erjh1
    automatically matched to 2ERJ C:130-226
    complexed with bma, fuc, nag; mutant

Details for d2erjg2

PDB Entry: 2erj (more details), 3 Å

PDB Description: crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2
PDB Compounds: (G:) Cytokine receptor common gamma chain

SCOP Domain Sequences for d2erjg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erjg2 b.1.2.1 (G:130-226) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}
vipwapenltlhklsesqlelnwnnrflnhclehlvqyrtdwdhswteqsvdyrhkfslp
svdgqkrytfrvrsrfnplcgsaqhwsewshpihwgs

SCOP Domain Coordinates for d2erjg2:

Click to download the PDB-style file with coordinates for d2erjg2.
(The format of our PDB-style files is described here.)

Timeline for d2erjg2: