Lineage for d2erjg1 (2erj G:32-129)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657225Protein Cytokine receptor common gamma chain [141041] (1 species)
  7. 657226Species Human (Homo sapiens) [TaxId:9606] [141042] (2 PDB entries)
  8. 657231Domain d2erjg1: 2erj G:32-129 [132299]
    Other proteins in same PDB: d2erja1, d2erja2, d2erjb1, d2erjb2, d2erjd1, d2erje1, d2erje2, d2erjf1, d2erjf2, d2erjh1
    automatically matched to 2ERJ C:32-129
    complexed with bma, fuc, nag; mutant

Details for d2erjg1

PDB Entry: 2erj (more details), 3 Å

PDB Description: crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2
PDB Compounds: (G:) Cytokine receptor common gamma chain

SCOP Domain Sequences for d2erjg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erjg1 b.1.2.1 (G:32-129) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}
tlplpevqcfvfnveymnctwqsssepqptnltlhywyknsdndkvqkcshylfseeits
gcqlqkkeihlyqtfvvqlqdpreprrqatqmlklqnl

SCOP Domain Coordinates for d2erjg1:

Click to download the PDB-style file with coordinates for d2erjg1.
(The format of our PDB-style files is described here.)

Timeline for d2erjg1: