Lineage for d2erjf2 (2erj F:6-103)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657489Protein Interleukin-2 receptor beta chain [141047] (1 species)
  7. 657490Species Human (Homo sapiens) [TaxId:9606] [141048] (2 PDB entries)
  8. 657496Domain d2erjf2: 2erj F:6-103 [132298]
    Other proteins in same PDB: d2erja1, d2erja2, d2erjc1, d2erjc2, d2erjd1, d2erje1, d2erje2, d2erjg1, d2erjg2, d2erjh1
    automatically matched to 2ERJ B:6-103
    complexed with bma, fuc, nag; mutant

Details for d2erjf2

PDB Entry: 2erj (more details), 3 Å

PDB Description: Crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2
PDB Compounds: (F:) Interleukin-2 receptor beta chain

SCOP Domain Sequences for d2erjf2:

Sequence, based on SEQRES records: (download)

>d2erjf2 b.1.2.1 (F:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sqftcfynsraniscvwsqdgalqdtscqvhawpdrrrwnqtcellpvsqaswacnlilg
apdsqklttvdivtlrvlcregvrwrvmaiqdfkpfen

Sequence, based on observed residues (ATOM records): (download)

>d2erjf2 b.1.2.1 (F:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sqftcfynsraniscvwsqdgdtscqvhawpdrrrwnqtcellpvsqaswacnlilgapd
sqklttvdivtlrvlcregvrwrvmaiqdfkpfen

SCOP Domain Coordinates for d2erjf2:

Click to download the PDB-style file with coordinates for d2erjf2.
(The format of our PDB-style files is described here.)

Timeline for d2erjf2: