SCOPe 2.02: Domain d2erje2: 2erj E:1-64

Lineage for d2erje2 (2erj E:1-64)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
   Pfam PF00084

6. Protein Interleukin-2 receptor alpha chain [144117] (1 species)
   consists of two segment-swapped SCR domains

7. Species Human (Homo sapiens) [TaxId:9606] [144118] (3 PDB entries)
   Uniprot P01589 121-186! Uniprot P01589 124-186! Uniprot P01589 125-186! Uniprot P01589 22-85

8. Domain d2erje2: 2erj E:1-64 [132296]
   Other proteins in same PDB: d2erjb1, d2erjb2, d2erjc1, d2erjc2, d2erjd1, d2erjf1, d2erjf2, d2erjg1, d2erjg2, d2erjh1
   automatically matched to 2ERJ A:1-64
   complexed with nag

Details for d2erje2

PDB Entry: 2erj, 3 Å

PDB Description: crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2

PDB Compounds: (E:) Interleukin-2 receptor alpha chain

SCOPe Domain Sequences for d2erje2:

Sequence; same for both SEQRES and ATOM records:

>d2erje2 g.18.1.1 (E:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
elcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctgssshsswdnqcq
ctss

Timeline for d2erje2:

• d2erje2 first appeared in SCOP 1.73
  
• d2erje2 appears in SCOPe 2.01
  
• d2erje2 appears in SCOPe 2.03
  
• d2erje2 appears in the current release, SCOPe 2.08